SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011382 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011382
Domain Number 1 Region: 1100-1188
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000263
Family PDZ domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011382   Gene: ENSMPUG00000011472   Transcript: ENSMPUT00000011570
Sequence length 1193
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897029.1:1198915:1237914:1 gene:ENSMPUG00000011472 transcript:ENSMPUT00000011570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMTSAVERSGREPQLHNGHLPRPWSCSLEDRTPSLMAPQHGRAWGMQLQGPSVLESKVR
ALKEKMSTGKQGVSPCLTSHERPSKKPKFRRVKGGAPEILSEQPSLPDAEEVLPTQNPPD
GQLDSGINKEEPAQNGGPRPPRPPSNGLECWNGRSPWPPEAVQALPDNEGSLPPGSGSLQ
ENFVHGVTLGRPGGPGPCDKVAHVPNLRKGRSYALQDGLGSGRDLDSLSLTCEEDFASRP
ALLGGLWRAAELGALGTGGSALSLSDQVEMNRLLLQEMLNVGGQVPPRVGIPAWTPSWDR
RPPERPAGDVDWDSGVSLQDSDQSRTFGPKPESVLSPRHEEAKHLLQRARMKARTRPLRA
SHEIVPAVAQGGRDDRRSPAPDARMPFACRDTPQNGNTSDSSSGESSSGQWPKRGASPSR
VRFEDESARDAESRYLERLRQRPARGGAGHSAAQGPLRSKPELAHYVRGGFARTDAGEGA
LCRLVGRLEQRGFPVPPARGSDRKCQACGSCLDDRRPGADPRALREREGAGGGPGVRAEP
LSARGPSPPFRPLPAEPGGHTEWIRETHIGDVVCPGEADSALDSTDTSDSCRTDSEEAGT
SQPSRARGPARSNSPRPRSSRPRGGPRWFRKVGLELPGSPQAPHYLPVVEHMEGVAEVTE
GRGHLPEGTRFPREDACAKPPTLESKKASLGSQQLPGPGLGNHWVHAVDSRALSRTAYLL
TPSTKLGSSVPGRQALDGGSHESLQTVSASSLQQSPAEPSALHQAQKPTSFSTEGWVPTP
PSSRKTTSPVSCRKAALARPRRQREPVDPPLPPPRSGVPRTCELSPAQTQPCSPPVRHPL
LALSTNNCNNSTPLRLQESPGGAGLEGKVEEGPCSQELPPENSSSHGGVQGFPDPAAAGT
VSSVSITLSLASEEPESSQEPEGGLQRPEMSPGGQVPSRASPGVSARPGPRSAAPSDRSK
KSSTSLVSTLGLKKLFQALGHGARPKLGKARSHSVEQLQPPAPGPVPHTSTPRVKKAPSL
QSLHLVSPSHQHRKAASFQNLHSLLSGKGDRSSLYMVGESGDHSAAGRVAKASPRRALSV
EDVSTPSQTRMVGRVVEVFPDGTTQLQLQRSPEGSFGFCVASGDGRRDTGFYVQEMADAS
MAKLYSGLLGVGDEILEVNGAKVAGLGLAHIKELLAHAESLSVRVLRQRPFPR
Download sequence
Identical sequences M3YJ75
ENSMPUP00000011382 XP_012919695.1.14098 ENSMPUP00000011382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]