SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011401 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011401
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-60
Family Ankyrin repeat 0.0000487
Further Details:      
 
Domain Number 2 Region: 806-876
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 880-925
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000628
Family SAM (sterile alpha motif) domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011401   Gene: ENSMPUG00000011491   Transcript: ENSMPUT00000011589
Sequence length 927
Comment pep:novel scaffold:MusPutFur1.0:GL896907.1:560728:1401086:-1 gene:ENSMPUG00000011491 transcript:ENSMPUT00000011589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIRDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSAAVEEHVQE
DTTQEIHISSPIESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEDDDDENTCGPSGLWEALTPCNGCRNLGFPI
LAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLTDIAVTKKPCSLEIARAPSPRTDN
ASEVAITAPGSSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHRM
NHNQEYFEINTSAGCASFTSSPPVSPPTSSVGTTEVKNEGTGHTDDPSQQEDSDPPKEYD
PGQFEGLLHGSSPACECPENPFHLYGKRDEREEGQDEVSLANSPLPFKKSPIANNSETLV
KKIKPKVVSRTIFHKKSNQLENHTIVGTRTTRSGSRNGDQWIMNTGGFVERACTLGRIRS
LPKALIDMHLSKTVSKSDSDLIAYPSNEKTSKVNWSESSTADHSSKGNSERTPSFTSEWE
EIDKIMNSIDVGINSELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQF
MGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDY
TKAFLINGYTSMDLLKKIWEVELINCC
Download sequence
Identical sequences M3YJ94
ENSMPUP00000011401 ENSMPUP00000011401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]