SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011404
Domain Number 1 Region: 1479-1604
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-24
Family Synaptotagmin-like (S variant) 0.0081
Further Details:      
 
Domain Number 2 Region: 321-433
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-16
Family Synaptotagmin-like (S variant) 0.082
Further Details:      
 
Domain Number 3 Region: 159-293
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-16
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 
Domain Number 4 Region: 1688-1859
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000249
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 5 Region: 2-105
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000612
Family PLC-like (P variant) 0.05
Further Details:      
 
Domain Number 6 Region: 1074-1208
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000483
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 7 Region: 1236-1340
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000546
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011404   Gene: ENSMPUG00000011494   Transcript: ENSMPUT00000011592
Sequence length 2053
Comment pep:novel scaffold:MusPutFur1.0:GL896935.1:6302399:6357273:-1 gene:ENSMPUG00000011494 transcript:ENSMPUT00000011592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLVVDSATINPPLSPPPRPCVTAYFRDIKRRTHEAEGNNPIWNETLIWYLWDCPLQND
SFLQIILRDVGAAKKDRFIGLATILLQPLVKKPSEVLSLKDLNLLNHLMQSTDCTVTLHV
TLARKQYASKLGDDLLGPSAQEVARRKLMVPGSGMPMALSSKPQHFQVRVKVFEARQLMG
NNIKPMVNVVIGGYQYNTRIKMGNNPFFNEIFFQNFYEVPAKLFDETILIQVMNSTLMRF
NSEIGRFQTDIGFIYYSPGHTLMRKWLGLCQPNEPNSGVRGYLKVTICVLGVGDQVLVDQ
EMPYGADDTTTEIFKSTVVPTNVAYLQFFIYCAEDLHLKKQHLASPVLEVELIGEKLKTN
VLTETENPIWNQILTFQIQLPCLSSYIRFRVLDCPKNSCQDEIGTVSLFLNQISSTGAEI
EGMYSGFLPCFGPSFLTLRGGKKAPFRIQEENTNIPDSLKDGLTYRGRIFLELSTHVTSH
QDLKRKDLSSEVISIERHRHRQKYGLCVIFLSCTMMPNFKDLIQFEVSIGHYGNKMDLNY
KPCVSTTQYSPVIYDGNIYHYVPWYNTKPVVAVISQWEDISFRMNCLNLLHFTRDRLKAN
LDTLKSIKNPRDPALLPQWEKLLRELVEDCKHPLPCMAHQPRATELDKKRWQLRSRLLQE
LSQKAKEVKPRNMVATVEDWLYRLNAVLPEPQMSLPDVMIWLMSKEQRVAYAQVPTHSIL
FSPTGALHSGRFCGKTQTLVLQYPEGEGQDMLPAHLRVCMWFGNISDSKNLQLLREGEVV
VYAETYENQAKYKDQWGQQGLYHCPNFSDVMGHKALPKEDFQAPQGWHWQGQWRVEPQRR
LLLDVDINKSQVLEEVYENQCRDTTGAWVPAAIPNTDMNGEPVEARENVQCPRGWHVKES
WIVELNHAVDSEGWEYGVAIEPSGQPRVWNSVEKTYYSCRRRRWVRVRCRNHGKLSLEEE
TLSFLQLHHPIPAKDEDGWEYGTFGSKFHLNPQPQSQFRRRCWHRRMVPNKDKGIAPIFR
LEGSLDMDLKEKGRKEEMRLTQAPDKTIRSSWRPAQEDIQLHALPFIYCIFNKPHYYQLF
CYIYQARNLMSNQIQTFQVPFIRLVFLNHSQCTQTLKSSAAPTWAQTLIFQHLLLYENPE
DTKASPPLVVLELWQQNAQGKESLWARSMWSPVVWLDVQKRTLPPLRWHPLVKLLGEKEG
EILVSCELILETESVKERPPILSVPWKNGVYTLPKSIQPTLKKMAVEILVWGLRNMKQVH
SPQLLVECWEESLQTEPIKDFQTNPNFKQSVLFLTLFIPTEEAYAPPLTLKVVDNQDFGQ
QTVVGQANIHSLQPYFCNPWAEDYVPPQLPMLSVNKYQKLLDYFYEKFWISPSKAQDQYQ
HEVDWWSKLFWATGDAKALQYKYKDYHTLKVYDCELEAVPAFEGLQDFCQTFRLYQEEPK
LDSPVVGEFKGLFRVYPFPEDPKAPKPPRQFLVWRNKEDFPQECLVRVYVVRAINLQPQD
SNGLCDPYVILKLGQTTMGNRDKYCPNTLNPIFGIMFELSCTIPLEKDLEIQLYDFDLFS
SDEKIGTTIIDLENRLLSGFGARCGLSKSYCYAGPFRWRDQMTPSFLLERHAKQKGLPPP
LFSPEEDTVFYNGKKFKLQSFEPKPPPVHYLGPKKERLALYLLHTQGLVPEHVETRTLYS
NSQPGIDQGKVQMWVDIFPKKLGPPGPPVNIRPRKPKRYELRCIVWKTAQVDLRRSLTTG
MSDIYVKGWLAGLEKDMQKTDIHYYSLTGESNFNWRFIFTMDYLAAERVCVESQKDYIWS
LDPTVMKFPARLIIQIWDNNIFSTDDFLGVLELDLFNMPLPTRHANLCSIRMMETNSKWP
YFLQYKHFSLFKKKTITGWWPAQVLDGGTWHMSGKVKMTLEILSEKEALIKPAGRGQSEP
NQYPTLHPPLRPNTLFILRSPVTILCRVFWKRYHFKIIIGAIIFIIALMLFNFIYSAPNY
LAMSWVKPELRLNAPIKTPTNIMNPPSSSNAHSSILTSQHQNLNSTTDHELKLLQGPMNR
LQDIFPELPAPQD
Download sequence
Identical sequences M3YJ97
ENSMPUP00000011404 ENSMPUP00000011404 XP_012911775.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]