SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011412 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011412
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 8.03e-56
Family Cofilin-like 0.0000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011412   Gene: ENSMPUG00000011502   Transcript: ENSMPUT00000011600
Sequence length 165
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:413638:414573:1 gene:ENSMPUG00000011502 transcript:ENSMPUT00000011600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVG
QTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSK
DAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSTVISLEGKPL
Download sequence
Identical sequences M3YJA5
ENSMPUP00000011412 ENSMPUP00000011412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]