SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011418 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011418
Domain Number 1 Region: 102-173
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011418   Gene: ENSMPUG00000011508   Transcript: ENSMPUT00000011606
Sequence length 245
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:6420285:6424077:-1 gene:ENSMPUG00000011508 transcript:ENSMPUT00000011606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSSWREGLQELGEQVFSDPMELYETSPYFYQEPHFYDGENYLPVHLQAFEPPGYERAE
LSLSPEARGPLEDKGLGTSEHCLGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNE
AFEALKRSTLPNPSQRLPKVEILRSAIQYIERLQALLSSLHQEERDLRYRAGGGPQPGVP
SECSSHSASCSPEWGSTLEFGPNTADHLLTADPADAHNLHSLTSIVDSITVEDVSVAFPD
ETMPN
Download sequence
Identical sequences M3YJB1
ENSMPUP00000011418 ENSMPUP00000011418 XP_004756393.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]