SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011423 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011423
Domain Number 1 Region: 29-169
Classification Level Classification E-value
Superfamily PX domain 0.00000000000818
Family PX domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011423
Domain Number - Region: 295-400
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.016
Family BAR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011423   Gene: ENSMPUG00000011514   Transcript: ENSMPUT00000011612
Sequence length 407
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:416464:420793:-1 gene:ENSMPUG00000011514 transcript:ENSMPUT00000011612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGMPEFSNQQTSPPQQPSSVSVDLQGDSTLQVEISDAVSERDKVKFTVQTKSCLPHFAQ
TEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSITREE
FAKMKQELEAEYLALFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRK
ELLGGFLRNIVKSADEALITSMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMHSH
KCLADDFIPISAALNSLGTQEVNQLKTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRY
YMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRTAESHQQLCCQRFERLSDSA
KQELMDFKSRRVSSFRKNLIELAELELKHAKASTLLLRNTLIALKGE
Download sequence
Identical sequences M3YJB6
ENSMPUP00000011423 ENSMPUP00000011423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]