SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011436 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011436
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.27e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 3.01e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011436
Domain Number - Region: 418-451
Classification Level Classification E-value
Superfamily ARM repeat 0.00512
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011436   Gene: ENSMPUG00000011527   Transcript: ENSMPUT00000011625
Sequence length 470
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896949.1:7835112:7869376:-1 gene:ENSMPUG00000011527 transcript:ENSMPUT00000011625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETQSAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEDEEEEDEDDDSADMDESDEEDEEERQRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences M3YJC9
XP_004756015.1.14098 ENSMPUP00000011436 ENSMPUP00000011436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]