SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011438 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011438
Domain Number 1 Region: 57-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000591
Family LIM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 25-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000129
Family LIM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011438
Domain Number - Region: 122-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000414
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011438   Gene: ENSMPUG00000011529   Transcript: ENSMPUT00000011627
Sequence length 158
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896949.1:7926060:7949693:-1 gene:ENSMPUG00000011529 transcript:ENSMPUT00000011627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Download sequence
Identical sequences A0A0D9QZ91 A0A151MBI1 A0A1U7R7E1 A0A1U8CGI3 A0A250YAJ8 A0A286XZV8 A0A2J8WG11 A0A2K6KAV3 A0A2K6R915 H2Q3E1 H9EM64 I3N8R7 I7GJC9 L5KXA4 M3YJD1 P25791 Q71LH8
9544.ENSMMUP00000010027 9598.ENSPTRP00000006061 9600.ENSPPYP00000003868 ENSP00000379175 ENSMPUP00000011438 NP_001135787.1.87134 NP_001135787.1.92137 NP_001135788.1.87134 NP_001135788.1.92137 NP_989602.1.86415 XP_002917543.2.58354 XP_004406150.1.74151 XP_004406151.1.74151 XP_004406152.1.74151 XP_004660886.1.11716 XP_004756016.2.14098 XP_005154234.1.78019 XP_005252978.1.92137 XP_005304611.1.60341 XP_005327482.1.77405 XP_005384209.2.28644 XP_005446152.1.10750 XP_005578293.1.63531 XP_005661083.1.46622 XP_006014729.1.24877 XP_006258523.1.47583 XP_006749431.1.47382 XP_006975957.1.50099 XP_007941460.1.48129 XP_007941461.1.48129 XP_008000625.1.81039 XP_008177749.1.60341 XP_008586194.1.73410 XP_009244761.1.23681 XP_009458474.1.37143 XP_009458485.1.37143 XP_009562693.1.62272 XP_010124200.1.88979 XP_010590440.1.64505 XP_011355105.1.92234 XP_011722352.1.29376 XP_011722353.1.29376 XP_011917582.1.92194 XP_011917583.1.92194 XP_011917584.1.92194 XP_011917586.1.92194 XP_011917587.1.92194 XP_012505115.1.63892 XP_012595355.1.48125 XP_012977580.1.91757 XP_013814998.1.3284 XP_014970010.1.72884 XP_014970011.1.72884 XP_015290423.1.63531 XP_015850297.1.50099 XP_016002611.1.101085 XP_016873216.1.92137 XP_016873217.1.92137 XP_016873218.1.92137 XP_016873219.1.92137 XP_016873220.1.92137 XP_016873221.1.92137 XP_016873222.1.92137 XP_017386034.1.71028 XP_017386035.1.71028 XP_017682309.1.3805 XP_017705226.1.44346 XP_017937346.1.51550 XP_019325608.1.44245 XP_019374956.1.87953 XP_019407775.1.79039 XP_019494966.1.44202 XP_019594160.1.88060 XP_019594161.1.88060 XP_020039149.1.5219 XP_021506474.1.76796 XP_021521014.1.9421 ENSPVAP00000008052 ENSPVAP00000008052 gi|214832121|ref|NP_001135787.1| gi|214832219|ref|NP_001135788.1| ENSMMUP00000010027 GO.44133 HR4482 ENSNLEP00000021762 ENSSSCP00000014139 ENSMPUP00000011438 ENSSSCP00000014139 ENSP00000379175 ENSMMUP00000010027 ENSPANP00000001634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]