SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011450 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011450
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 9.07e-52
Family Phosphotyrosine-binding domain (PTB) 0.0000676
Further Details:      
 
Domain Number 2 Region: 530-605
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.00005
Further Details:      
 
Domain Number 3 Region: 725-771
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000763
Family Pointed domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011450   Gene: ENSMPUG00000011541   Transcript: ENSMPUT00000011639
Sequence length 821
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896948.1:8162807:8343436:1 gene:ENSMPUG00000011541 transcript:ENSMPUT00000011639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNHPSGFGMYQAQMNGYGTSPTFSQMDREHSSKTSAKALYEQRKNYARDSVSSVS
DISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLE
SKNELENFPLSTIQHCQAVMHSCNYDSILALVCKEPTQNKPDLHLFQCDEIKANLISEDI
ESAISDSKGGKQKRRPEALRMISKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWA
ADQGDFEKPRQYHEQEEPPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKR
KKSKKGKKKGPGEGVLTLRAKPPPPDEFIDCLQKFKHGFNLLSKLKSHIQNPSAADLVHF
LFTPLNMVVQATGGPELASSVLSPLLTKDTIDFLNYTVNNDERQLWISLGETWMKARAEW
PKEQFIPPYVPRFRNGWEPPMLNFMGAPMEQDLYQLAESVANVAEHQRKQETKRLSTEQS
GVSEYPPADGYAFNNMYTRGPHLDQGEAAVAFKPTPNRHVDRNYEPLKAQPKKYAKSKYD
FVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPP
YTHTIQKQRMEYGPRPTDTPSAPSPPPTPAPVPVPLPPSTPAPVSVPKIPANVTRQNSSS
SDSGGSIVRDNQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVVNI
TYDSTPEDVKTWLQSKGFSPVTVNSLGVLNGAQLFSLNKEELRTVCPEGSRVFSQITVQK
AALEDNSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences M3YJE3
ENSMPUP00000011450 ENSMPUP00000011450 XP_004755820.1.14098 XP_004755821.1.14098 XP_004755822.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]