SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011494 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011494
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.14e-158
Family Myotubularin-like phosphatases 0.0000000000308
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-42
Family GRAM domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011494   Gene: ENSMPUG00000011585   Transcript: ENSMPUT00000011683
Sequence length 603
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897133.1:519976:611113:1 gene:ENSMPUG00000011585 transcript:ENSMPUT00000011683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPASKYNSHSLENESIKRTSRDGVNRDLSEAVPRLPGETRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFEILTRYAFPLAHSLPIFAFLNEEKFNVDGWMVYNPVEEYRRQGLPN
HHWRISFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPNVNAVANKATGGGYESDDA
YHNTELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQV
ADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLITILDHLYSCRFGTFLY
NCESAREKQKVTERTVSLWSLINSNKDTYKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYVELLALRDEYIQRLEELQLASSAKLSDPSTSPSGPAQMMPHVH
THF
Download sequence
Identical sequences M3YJI7
XP_004776681.1.14098 XP_012903369.1.14098 XP_012903370.1.14098 ENSMPUP00000011494 ENSMPUP00000011494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]