SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011501 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011501
Domain Number 1 Region: 162-547
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.92e-159
Family Myotubularin-like phosphatases 0.0000000000103
Further Details:      
 
Domain Number 2 Region: 38-160
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-40
Family GRAM domain 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011501   Gene: ENSMPUG00000011593   Transcript: ENSMPUT00000011691
Sequence length 605
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897133.1:641300:682234:1 gene:ENSMPUG00000011593 transcript:ENSMPUT00000011691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKARQRLEVQEEHNGYPSEAEADQALRDGNKLAQMEETPLFPGESIKATVKDVMYICPF
MGAVSGTLTVTDFKMYFKNVERDPNFVLDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDM
RNLRLAYKQEEQSKLGIFENLNKLAFPLSNGQILFAFSYKEKFPMNGWKVYDPVSEYKRQ
GLPNESWKISKVNSNYELCDTYPAVIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQ
ATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKAKGGGYE
SESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSSVDGTHWLEYIRMLLAG
AVRIADKIESGKTSVLVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFEVLVEKEWISFGH
RFALRVGHGDDNHADADRSPIFLQFIDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFG
TFLCNCEQQRFKEDVYTKTISLWSYVNSQLEEFSNPFFVNYENHVLYPVASLSHLELWVN
YYVRWNPRMRPQMPIHQNLKELLAIKAELQKRVEDLQREVATRASSSSERGSSPSHSVTP
VHTSV
Download sequence
Identical sequences M3YJJ4
ENSMPUP00000011501 ENSMPUP00000011501 XP_004776684.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]