SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011508 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011508
Domain Number 1 Region: 18-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-20
Family Synaptotagmin-like (S variant) 0.00000427
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011508
Domain Number - Region: 124-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000171
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011508   Gene: ENSMPUG00000011600   Transcript: ENSMPUT00000011698
Sequence length 168
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897656.1:14429:18894:-1 gene:ENSMPUG00000011600 transcript:ENSMPUT00000011698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPPPLVLAKSHDCVAVSLAAAVTSGHDGGCDCYVQGSVANRTGTVEAQTALKKRQLHT
TWEEGLVLPLAEEELPTATLRLTLRTCDRFSRHSVLGELCLGLDGASGPLGAAQWGELKT
SVKEPSAGTGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKALLGKGE
Download sequence
Identical sequences M3YJK1
ENSMPUP00000011508 ENSMPUP00000011508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]