SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011513 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011513
Domain Number 1 Region: 1217-1350
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 2 Region: 599-663,701-764
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-18
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 3 Region: 821-923
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-16
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011513
Domain Number - Region: 1119-1198
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000327
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 27-120,706-726
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00045
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011513   Gene: ENSMPUG00000011605   Transcript: ENSMPUT00000011703
Sequence length 1494
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:7131247:7255554:1 gene:ENSMPUG00000011605 transcript:ENSMPUT00000011703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSETEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEEKLKAANIQTSESETRLYKKCQDLETLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTLKLNELELENQNLRLINQNQTEEIRTLQSKLQEVQGKKSSTLSTP
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISFKEPEFTEGKDVEEMEIPEKSGEK
QIQENNRGQRTLPQTPCVPEQNRKTRTSFATDGGTSQNSGAPGSDWSSDEEDGSKGRSKC
RYTSTLSSHTSEEGVHCSRMCSEAYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KAQNCPLVKGNSESSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALTPKHP
NPLPGKCMQLVPSSNLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDDDSTEILENMDTSCDDGLFSHDSLESPCSDDQEPSDSAKKLACGDPD
CSETSHFSEYCESRIYAVAKSGIRMSEAFNMENVNKNSVALLSYTTSGLYTSLIYKNMTT
PVYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDTRNRSGPGSPRAMKRGVSL
SSVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGRVKT
WKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCGILRGDNKQTVQKINEKRARTLIY
LSPNLKFQAESIGRSFLRFQGSSGFCLKEEERKEGRKERKKVKHGYSKRVWCTLIGKTLY
YFRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYL
LIGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGEPSSQIWRHPTLCHSKEG
IISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLTHPELQNE
ICCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGK
YAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDA
STTVEEFLNTLNQDTGMRKPTQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKE
QQPGKWEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEM
AALLAQVEIGDFERPFSTPAGHVTNQCKTNQTLKQVIEKFYPKRYRDGSSEEQLRQLCQR
LSTRWMALRGHSVADCVRIYLTVARKWPFFGAKLFLAKPVTPSALGSTFTWLAIHEDGLS
LLEYNSMRLIVSYVYKSLMTFGGHQDDFMIVINNTHSKDKPTEKLLFAMAKPKILEITLL
IASYINNFHQQKATFHHLSAPALLSAQTRGPEARAMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences M3YJK6
ENSMPUP00000011513 ENSMPUP00000011513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]