SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Mustela putorius furo 76_1.0 > ENSMPUP00000011514

Domain assignment for ENSMPUP00000011514 from Mustela putorius furo 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMPUP00000011514
Domain Number 1	Region: 81-162
Classification Level	Classification	E-value
Superfamily	HMG-box	5.89e-32
Family	HMG-box	0.0000214
Further Details:

Domain Number 2	Region: 3-79
Classification Level	Classification	E-value
Superfamily	HMG-box	4.06e-26
Family	HMG-box	0.0000169
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMPUP00000011514 Gene: ENSMPUG00000011606 Transcript: ENSMPUT00000011704
Sequence length	201
Comment	pep:novel scaffold:MusPutFur1.0:GL897133.1:830164:831890:1 gene:ENSMPUG00000011606 transcript:ENSMPUT00000011704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI GDVAKKLGEMWNNLSDGEKQPYNNKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV EEDDEEDEEEEEEEEEEEEDE
Download sequence
Identical sequences	M3YJK7 ENSMPUP00000011514 ENSMPUP00000018241 ENSMPUP00000011514 ENSMPUP00000018241 XP_004833944.1.14098 XP_012903382.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]