SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011519 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011519
Domain Number 1 Region: 380-546,846-1064,1110-1150
Classification Level Classification E-value
Superfamily Ras GEF 1.12e-106
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 527-614
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 3 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-18
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 15-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000114
Family cAMP-binding domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011519
Domain Number - Region: 756-835
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000157
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011519   Gene: ENSMPUG00000011611   Transcript: ENSMPUT00000011709
Sequence length 1610
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:400543:596773:1 gene:ENSMPUG00000011611 transcript:ENSMPUT00000011709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALKKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQILFCSETVARCWYILLSGSVLMKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVDINSYLSLPADLTKMHITDNPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLMEFMHQLPAFANMTMSVRRELCTVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEITHPDGKVENLFMGNSFGITPTLDKQYMHGVVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLQSPLDVGIKLLEWFKIDNLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLHFSLNGGSEKGFGIFVEGVEPSSKAADAGLKRGDQIMEVNGQNFENITFVKALEILRN
NTHLALTVKTNIFVFKELLSRTEQEKSGIPHIPKIAEKKSNRHSIQDVPGDIEHTSQEKG
NKKIKANTVSGGRNKIRKILDKTRFSILPPKLFRRLFCDGGLSHSQDDSIVGTRHCRHSL
AIMPIPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEV
VCHAVHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMET
ETLCSDEDAQELVKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTG
NTHLKEFEDIVNQETFWVASEILTESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISG
LNLASVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVV
KKDMTFLHEGNDSKVDGLVNFEKLRMIAKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNS
NMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVDTDEEKFQMMSLQWEP
AYGTLTKNLSEKRSAKSSEMSPVPMRSAGQTAKAHLHQPHRVSQVLQVPAVNLHPIRKKG
QAKDPATLNTNLPQKVLGTTEEISGKKHPEDTISVASSLHSSPPASPQGSPRKGYTLTPS
AKSDNLSDSSHSEISSRSSIVSNCSVDSMSTALQDERCSSQPVAVPESTGPLEKTEHSSG
IGDHTQLGPGWTLSKPSLVKSLAVSSSMSNEEISHEHVILEAADSGRGSWTSCSSSSHDN
FQSLPNPKGWDFLNAYRHTHLDGPIAEVELPDCEPYSCPKGCSRTCGQCKGNLETNQMRQ
SWASSSSLSDTYEPNYGTVKRRVLESIAPESSEGLDPKDGTDPVYKTVTSSTEKGLIVYC
VTSPKKEDRYREPPPTPPGYMGISLADLKEGPYLHLKPPDYSVAVQRSKMMHDSLSRLPP
ASLGSSPVACVPSKIVTQPQRQILQPSHPKLADVTDADSEADENEQVSAV
Download sequence
Identical sequences M3YJL2
ENSMPUP00000011519 ENSMPUP00000011519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]