SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011523 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011523
Domain Number 1 Region: 28-258
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.67e-73
Family Ecto-ART 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011523   Gene: ENSMPUG00000011615   Transcript: ENSMPUT00000011713
Sequence length 265
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896948.1:9066532:9074989:1 gene:ENSMPUG00000011615 transcript:ENSMPUT00000011713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLWLLHLLLLFSGLQTPTWSSEVAVNIDFDLAPDSFDDQYQGCSPQVMEKLRQGDYFTK
EIEAHRDYHGVWKKAHLTWLNRAKDIPKNMNITHVLAILVYTSNNSVHTSFTRAMANAGR
SPQHYERSFHFKYLHYYLTSAIQLLRKEMVMKNDSLCFEVYHKMKGINLEAYSGATIRFG
QFLSTSLLKEEAQKFGNQTLFTIFTCLGAPIPEDSRKKEVLVPPYELFKVVNMSHHPRGN
WLQLRSAGNMSTYNCQLLKGIILSI
Download sequence
Identical sequences M3YJL6
ENSMPUP00000011523 ENSMPUP00000011523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]