SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011572 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011572
Domain Number 1 Region: 62-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000539
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 31-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000224
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011572
Domain Number - Region: 121-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0748
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011572   Gene: ENSMPUG00000011666   Transcript: ENSMPUT00000011764
Sequence length 407
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:693409:699727:1 gene:ENSMPUG00000011666 transcript:ENSMPUT00000011764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGELGPGRESAGGDLLLALLARREDLRREIPLCAGCDQHILDRFILKALDRHWHSKC
LKCTDCHAPLAERCFSRGENVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHC
FACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQRGQWGAGRDPRPEPAAGRSLRGANL
SASPPTARTGGGRPGRDDPPAPRKPGSRALAACFHPRGAEEKRLKKDAGRQRWGQYFRSM
KRARGGPKSDKDSAQEEGQDSDADVSFTDEPAVAEMGPANGLYSSLGESTPALGRPSGAP
GSFPLEHGGLAGPEQYRELRPGSPYGVPPSPAALQSLPGPQPLLSGLVYPDAGLGLVPAG
APGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHGQF
Download sequence
Identical sequences M3YJR5
ENSMPUP00000011572 ENSMPUP00000011572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]