SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011605 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011605
Domain Number 1 Region: 989-1339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.67e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 806-986
Classification Level Classification E-value
Superfamily ARM repeat 3.26e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00023
Further Details:      
 
Domain Number 3 Region: 642-789
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.45e-34
Family PLC-like (P variant) 0.0086
Further Details:      
 
Domain Number 4 Region: 321-477
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.67e-32
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 5 Region: 1367-1497
Classification Level Classification E-value
Superfamily PX domain 1.7e-28
Family PX domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1506-1633
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.04e-27
Family Synaptotagmin-like (S variant) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011605   Gene: ENSMPUG00000011699   Transcript: ENSMPUT00000011797
Sequence length 1637
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:7506886:7573155:-1 gene:ENSMPUG00000011699 transcript:ENSMPUT00000011797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRAKQNTDPSLISW
DEPVLDFYSKPAGRQKDLRLLRGLSGSDPTLNYNSLSPQEGLSNHSTSQGSQPGPDPWPK
GSLARDYLYIFDGSDEGLSLSPGDLGPGDIDGSSKKLSPPPLPPRVSIWDTPPLPPRKGS
PSSSKISQPNDVNTFSPVEQPAGKLLGRRILEEEGLGDGGPGRLLGPVDYDGINDAITRL
NLKSTYDAEMLRDTTRGWKEGRGPLDFGGKDTPGKPVARSKTMPPQVPPRTYASRYANGK
NMTPGKNRRISAAPADSRRHAVANGHELFEVSEERDEEVAAFCHMLDVLRSGSDIQDYSL
TGYVWSAVTPSPEHLGDEVNLKVTVLCDSLQEPLTFTCNCSSTVDLLIHQTLCYTHDELR
DVDVGNFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKAVRSDLARTVND
DQSPSTLNYLVHLQERPVKQTISRQALDLLFDTYHNEVDAFLLADGDFPLKADRVVQSVK
AICNALAAVETPEITSALNQLPPCPSRMQPKIQKDPTVLAVRENREKVVEALTAAILDLV
ELYCSTFDADFQTAVHGSRKHDLVQEACHFTGPLAFTVYATHRIPITWATSYEDFYLSCS
LSHGGKELCSPLYTRRAHFSKYLFHLIIWDQQICFPIQVNRLPRETLLCATLYALPIPLP
GSSSEANKQRRLPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQESPSARWSAPNFHQPD
SVILQIDFPTSAFDIKFTSPPGDKFSPRYVFGSLREEDQRVLKNIMRKESLYWLTDADKK
RLWEKRYYCHLEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQ
EVRRMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWL
LKDGLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVSTLAKLAQQVREAAPSARQG
ILRTGLEEVRQFFALIGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGEN
IRVIFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAET
LRKIQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRH
NDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDF
VDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFT
RLIECSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFAPRTHTLKSSGRISDVFLCRHEK
IFHPNKGYVYVVKVMRENAHEATYIQRTFEEFQELHNKLRLLFPSSQLPSFPSRFVIGRS
RGEAVAERRREELNRYIRHLTHEAPEVAECDLVYTFFHPLPRDEKAAGTSPAPKSSDSSW
ARPVGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKKK
TKVARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLA
QEKTGWFALGSRSHETL
Download sequence
Identical sequences M3YJU8
ENSMPUP00000011605 XP_004756452.1.14098 XP_004756453.1.14098 XP_012913647.1.14098 ENSMPUP00000011605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]