SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011614 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011614
Domain Number 1 Region: 1791-1889
Classification Level Classification E-value
Superfamily BRCT domain 2.09e-20
Family 53BP1 0.072
Further Details:      
 
Domain Number 2 Region: 29-134
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000362
Family FHA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011614   Gene: ENSMPUG00000011708   Transcript: ENSMPUT00000011806
Sequence length 1953
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897304.1:261535:333505:1 gene:ENSMPUG00000011708 transcript:ENSMPUT00000011806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQAVNWDVEEEEETERCSESLRCSLEPVGRLHIFSSAHGPEKDFPLYLGKNMVGRMP
DCSVTLPFSSISKQHAVIEILAWDKAPVLQDCGSLNGTQVLRPPKVLSPGVSHRLRDQEL
ILFADLPCQYHRLNVPLPFVSRGPLTVEETPRVQGGTQPQRLLLAEDSEEEVDSPSERCV
MKGPRTSPLAAVVPESDEEGPSPAPDGPGPPFAFSLDSDTDEEESQHPAAGEAFLAARRG
STAETEQPTAVATEIQLEKDQCSVKERNNGTEVERDARNGVVPLGATLARNQTAEEDSDT
DMDERRPAEVLWKRAQPSGFTDSDTDVEEEGIPATPAVVPTKKRQILHEISKKIPQAPAL
VHLQESPANNDTDVEESEFQLAVPPERNQASVVIDSNTDDEEEVLAALTLAHLKESQADT
WNRGTDVEESRAQPVALLEQNQTSAGRDSDTDSEEKGLPIEKKGTVPKCHIDKAYSEKRQ
SPLQDCDLGVDEDKSSLGAHLQRSQASATVDINTQVEEKTLSGPAVTLVEKHQVPMVWTN
QTNVEVEGGQAKLPVMHLEETQPPPPGDCETGAEEGTSLAASVVADTGKCQLPAEGDAGM
EWAAAVPEQERALEARAQGESLVSQVEQDLLPVSRENLTDLVVDTGTSGEPIQPQREGAQ
TPTERERELHVDRTKDSGDNHGDSEDLDLQATQCFVERENQSPEVQSMEDEATQAFLVTL
PQDPGPSCCSFQAPGALDEPWEVLATQPFCPRESEASEPHPIAAHLDAHGSCPSTPRTPP
QAQHPEIPGHEEALGTQGRGMQTVENDMGTPREAAEGVTPERGLLNRETKNLPAEEREDV
IGEEELTRGKQMLARDNQGQESDQKVKSASIERNTETLNIEIEIPREVQEEEIGKQTLAR
EVFEREAEKLVLEREDEPSGLGIEVPEEKLESGPQRGETEKGSQDQEGQASHLTPEPRAG
TGDHQGLTSTPGASGNQSDGAPISPRRQQRGHWTCKMPPAEKASAGDQESADACLPPAVP
EASALHHNSLLSQSQKHPVPQPFHSPSPSSLEPIPRTRQNGNQEVPETTLSSDMEPLHSK
SKVRLQGSSRKTPSAVSSLALEPHSTIPTDQPLSPELTSRVTRGRTRRSSVMTPELVVPT
APELQTSTSKDQPVIPESTLPVTRGRTNRFSVKTPELVVPIVPTVKPSTSKEQPAATELI
SQSRTHKSVKTPEPVVSTATQGRAHRSSDKTPKTVIPIAPELQPSTSKDQPVTPERTSRV
TWGRTRRSSIKTPQPTVPTVPELQPSTSKDQSIITEPISGATHSRTYRSSGKTSEPHIPT
APKVQPSIATDQPVTPEPTSRVTWGRTRRSSVKTPKPTVPTVPELQPSTSKDQPVITEPT
SGAPHSRTHRSSGKTPEPVIPIAPEVQPSIPTDQPVIPKPTSQGRTPRSSIKTPEPIVPT
APEPQLTTPGGQPVTPKRTSRGRTPRSSSKTPKSIVYTVPELQASTPTNQPVTPKLISLA
TRGRTQRSSIKTSEPVAPTAPELQPSLSTDQPVTPEPTSRATRGRTHRSFVKIPQPTELR
APDLESLTPTDQLVTPKAQGFQGKTLRSSGISAGPVLTTPEFQSPVPTDQPLPPEPISQA
NCSRKLRATRKYGSLTAPIVCEPYSALPESKSQSSRNQRQGAMRVVESLRTTPKPALAQL
PEAPTHATQIQKVEGAGRSEFTPEPLPKASQSCKRPLATVDSPPLQKRLQRGEVTQKTVF
LKEEEEDPMKRPRKEEDVVAPGPGKRKRDQAEEEPKGLPSRSLRRTKPNQESTAPKVLFT
GVVDARGERAVLALGGSLASSVAEASHLVTDRVRRTVKFLCALGRGIPILSLDWLHQSRK
AGCFLPPDEYVVTDPEQEKNFGFSLRDALSRARERRLLEGYEIHVTPGVQPPPPQMGEII
SCCGGTVLPSMPRSYKPQKHLFHSTAIISSLWP
Download sequence
Identical sequences M3YJV7
ENSMPUP00000011614 ENSMPUP00000011614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]