SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011615 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011615
Domain Number 1 Region: 772-1063
Classification Level Classification E-value
Superfamily L domain-like 5.27e-47
Family Ngr ectodomain-like 0.067
Further Details:      
 
Domain Number 2 Region: 325-722
Classification Level Classification E-value
Superfamily L domain-like 2.66e-38
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 3 Region: 1-151
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.95e-37
Family Cofilin-like 0.00000257
Further Details:      
 
Domain Number 4 Region: 168-293
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.49e-28
Family Cofilin-like 0.0015
Further Details:      
 
Domain Number 5 Region: 1160-1311
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.84e-26
Family Toll/Interleukin receptor TIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011615   Gene: ENSMPUG00000011709   Transcript: ENSMPUT00000011807
Sequence length 1327
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897233.1:109635:127127:1 gene:ENSMPUG00000011709 transcript:ENSMPUT00000011807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASRELMGTWEQDYDRAVLPL
LDTQEPCYLLYRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDE
LFGTVKDDLSFAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLTF
PLQPAAQRALQQLRQKTVNYIQLKLDLERETIELVHTEPTEVAQLPSRVPRDAARYHFFL
YKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFQLEISKKGPYFGA
LHPLSLLVQAAMLAMVLAPGALPPFLPCELQPHGLVDCKWLFLKSVPRFSATAPCGNITS
LWLHSNRIHHLHDSDFVQLSGLRRLNLKWNCPPAGLSPMHFPCHMTIEPNTFLAVPTLEE
LNLSYNGISTVPALPSSLTSLVLSRTNILTLDPASLAGLHALRHLYLDGNCYYKNPCQEA
LQVAPGALLGLSNLTHLSLKYNNLTVVPRHLPPSLESLLLSYNHIVTLVPDDLANLTALR
VLDIGGNCRRCDHARNPCRECPRGFPKLHRDTFRHLSHLEGLVLKDSSLHSLDPRWFRGL
GNLLTLDLSENFLYDCITKTKAFHSLGRLRKLNLSFNYHKKVSFAQLPLAPSFGSLRSLW
KLDMHGIFFRSLSETTLRPLAHLQVLQHLRLQLNFISQAQLSIFGAFPGLRYVDLSDNRI
SGAAEPPAAAGQVGGVERGRRLPGDLAPGPRGPRGPPSSEDFMLSCKGLPFTLDLSRNNV
VTVQSEMFTQLSRLQCLCLSHNSISQAVNGSQFTPLTSLRVLDLSHNKLDLYHGGSFTEL
PQLKALDLSYNSQPFSMRGVGHNLSFVAQLPALRYLSLAHNDIHSRVSQQLRSASLKALD
FSGNALSQMWAEGDLYLRFFQGLRNLVRLDLSQNRLHILLPRNLAHLPRSLQLLRLRDNY
LAFFNWSSLALLPRLEALDLAGNQLKALSNGTLPNGTLLQRLDLSGNSIGFVDPGFFALA
ERLREINLSANALKTVEPSWFGPVAGALKVLDVTANPLHCACGAAFVDFLLEVQAAVPGL
PSHVRCGSPSQLQGRSIFAQDLRLCLDEALSWDCFGLSLLTVALSLAVPMLHHMCGWDLW
YCFHLGLAWLPRRGRQWGADALPYDAFVVFDKAHSSVADWVYNELRVQLEERRGRRALRL
CLEERDWLPGKTLFENLWTSVYSSRKTLFVLAHTDSVSGLLRASFLLAQQRLLEDRKDVV
VLVILCPDAHRSRYVRLRQRLCRQSVLLWPQQPRGQRSFWAQLGTALTRDNRHFYNRNFC
RGPTTAE
Download sequence
Identical sequences M3YJV8
ENSMPUP00000011615 XP_004780118.1.14098 ENSMPUP00000011615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]