SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011671 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011671
Domain Number 1 Region: 51-378,408-520
Classification Level Classification E-value
Superfamily Ras GEF 1.07e-122
Family Ras GEF 0.0000633
Further Details:      
 
Domain Number 2 Region: 639-734
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-40
Family Ras-binding domain, RBD 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011671   Gene: ENSMPUG00000011765   Transcript: ENSMPUT00000011863
Sequence length 768
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897029.1:3894314:4015136:1 gene:ENSMPUG00000011765 transcript:ENSMPUT00000011863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
TSPNCEEDGSPSSSESRTVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLDYLKRMMP
GSDPERRAQNLLEQFQKQEVETDNGFPSTIFFSLEEEEELEVGGPAEFTSFPEDLVAEQL
TYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVASTVLGGKEL
KTQQRAKVIEKWINIAHECRILKNFSSLRAIISALQSNSIYRLKKTWAAVPKDRMLMFEE
LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDPKFIQWF
QRQQLLTEEESYALSCEIEAAADASATSPKPRKSMVKRLSLLFLGSDIITSSTPTKEQPK
STASGSSGESMDSVSVSSCESNHSEAEEGSITPMDTPDEPQKKLSESSSSCSSLHSMDTT
SSGMSSLMNPLSSPPSCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKNPMEEQVKLRSRTSLTLPRTAKRGCWSNRHSKVTL
Download sequence
Identical sequences M3YK14
ENSMPUP00000011671 XP_004768000.1.14098 ENSMPUP00000011671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]