SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011676 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011676
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-27
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011676
Domain Number - Region: 389-437
Classification Level Classification E-value
Superfamily YbjQ-like 0.000262
Family YbjQ-like 0.0063
Further Details:      
 
Domain Number - Region: 932-1025
Classification Level Classification E-value
Superfamily YbjQ-like 0.00209
Family YbjQ-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011676   Gene: ENSMPUG00000011770   Transcript: ENSMPUT00000011868
Sequence length 1054
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897123.1:443792:541338:-1 gene:ENSMPUG00000011770 transcript:ENSMPUT00000011868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEV
DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRG
EINVIVKVDLFNDLNRFRQSSCGVKFFCTTSIPKCYRAVIIHGFVEELVVNEDPEYQWID
RIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACNSPSKEMKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFFTLTAFPPGF
LMHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSI
CEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPAGCGFCHIPYDELNMPFPAHL
TYCCNCRKQKVPDVLFTTIDLPIDATVIGKGCLIQARLCRLKKKAQAEANATAISNLLPF
MEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLASATGVYLAALPTPGGIQIAGK
TPNDGSYEQHISHMQKKINDTIAKNKELYEINPPDISEEIIGSPIPEPRQRSRLLRSQSE
SSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDVPPPSGFYSCNTEIMPGINNWTS
EIQMFTSVRVIRLSSLNLTNQALNKNFNDLCENLLKSLYFKLRSMIPCCLCHVNFTVSLP
EDELIQVTVTAVAITFDKNQALQTTKTHVEKSLQRASQASTDNEELLQFPLELCSDSLPS
HPFPPAKEHLESASSNSGIPAAQRATSVDYSSFADRCSSWIELIKLKAQTIRRGSIKTTV
TVEKASPMGEGNFRNRSAPPCANSTVGVVKMTPLSFIPGAKITKYLGIINMFFIRETTSL
REEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYIMKQCVFMENPNKNQAQCLINVSG
DAVVFVRESELEVLSTQQPTANCQPSCPGGEVTT
Download sequence
Identical sequences M3YK19
ENSMPUP00000011676 ENSMPUP00000011676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]