SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011685 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011685
Domain Number 1 Region: 320-529
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.64e-51
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 181-317
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.29e-41
Family Domain of poly(ADP-ribose) polymerase 0.00014
Further Details:      
 
Domain Number 3 Region: 39-153
Classification Level Classification E-value
Superfamily WGR domain-like 2.35e-35
Family WGR domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011685   Gene: ENSMPUG00000011779   Transcript: ENSMPUT00000011877
Sequence length 531
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897233.1:343071:351845:-1 gene:ENSMPUG00000011779 transcript:ENSMPUT00000011877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKRKSQVPHEGPDKKQGRQGAEEEDNFRSTAEALRAAPTEKHTVRVDPACPLSHSPRT
QVHEDYACTLNQTNIGSNNNKFYIIQLLEEGDRFACWNRWGRVGEVGQSKLSYFKLLEDA
KKDFEKKFRDKTKNSWAERDHFVAHPGKYTLIEVQGDDEAQEAVVKVDGGPVRSVVQRVR
PCSLDAATQKLITNIFSKDMFKNAMTLMNLDVKKMPLGKLSKQQIARGFEALEALEAALR
APADGGLSLEELSSHFYTVIPHNFGRNRPPPINSPELLQAKKDMLLVLADIELAQTLQAT
PEEEKVEEVPHPLDRDYHLLKCQLELLDPKAPEYKVIRTYLEQTGNSYRCPALQHVWKVN
REGEGDRFQAHSKLGNRKLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKS
ASYVTGMSCGAHQLGYMFLGEVALGREHHITVDDPSLKQPPPGFDSVIARGHTEPDPTQD
TELELDGQRVVVPQGRPVLCAEFSSSRFSQSEYLIYQDSQCHLRYLLEVHL
Download sequence
Identical sequences M3YK28
XP_004780143.1.14098 XP_012905214.1.14098 XP_012905215.1.14098 XP_012905216.1.14098 XP_012905217.1.14098 XP_012905218.1.14098 ENSMPUP00000011685 ENSMPUP00000011685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]