SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011716 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011716
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-21
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011716   Gene: ENSMPUG00000011809   Transcript: ENSMPUT00000011908
Sequence length 221
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897154.1:283419:315714:-1 gene:ENSMPUG00000011809 transcript:ENSMPUT00000011908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRHSVEDKIHMPVDCINIRIGH
ECWDIQPPDGKPKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTGYVGSDVLY
DETAVASSPPPYTAYAAPTLETYGYGPYSGAYPPGTQVAYATNGQAYAVPYQYPYAGLYG
QQPTNQVIIRERYRDSDSDLALGMLAGAATGMALGSLFWVF
Download sequence
Identical sequences M3YK59
ENSMPUP00000011716 XP_004777823.1.14098 XP_012904045.1.14098 ENSMPUP00000011716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]