SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011738 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011738
Domain Number 1 Region: 114-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-76
Family Protein kinases, catalytic subunit 0.0000154
Further Details:      
 
Domain Number 2 Region: 38-110
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011738   Gene: ENSMPUG00000011832   Transcript: ENSMPUT00000011931
Sequence length 863
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:586142:601421:1 gene:ENSMPUG00000011832 transcript:ENSMPUT00000011931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLKNLFLKSPLGSWNGSGGGGGGGGGSGVWPEGSPKTAAYANPVWTALFDYEPNGQDE
LALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRL
EEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIAL
KAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIH
RDLKSNNILLLQPIEGDDMDHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTF
SKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCW
AQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLS
REEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFK
RSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAE
PGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRLDEATWYLDSDDSSS
LGSPSTPPMLNGNPQRPSPEPEEPRRTGPVERGSGSGTPKLIQRALLRGTALLASLGLGR
DLQTPPPPGGPGRERGETPPPTPRALPTVSPAEPPPSQPIRFSPKTLDVPASLLTPEAPG
PPAPAPLLLELGVPVGQLSAKSPRRHDEERRGSTVSPPPGISRSAPGTPGTPRSPPLGLI
SRPRPSPLRSRIDPWSFVSAGPRPSPLSSPQPAPRRAPWTLFPDSDPFWDSPPANPFRGG
PQDCRAQTKDIGAQAPWAPEAGP
Download sequence
Identical sequences M3YK81
XP_004770094.1.14098 ENSMPUP00000011738 ENSMPUP00000011738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]