SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011762 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011762
Domain Number 1 Region: 402-487
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.35e-25
Family Surp module (SWAP domain) 0.001
Further Details:      
 
Domain Number 2 Region: 266-355
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.93e-21
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 3 Region: 538-674
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000471
Family RPR domain (SMART 00582 ) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011762   Gene: ENSMPUG00000011855   Transcript: ENSMPUT00000011955
Sequence length 1029
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896943.1:5288669:5342041:-1 gene:ENSMPUG00000011855 transcript:ENSMPUT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNEST
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKK
DKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERS
HKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRS
HKKSKKNKH
Download sequence
Identical sequences M3YKA5
XP_004754523.1.14098 ENSMPUP00000011762 ENSMPUP00000011762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]