SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011787 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011787
Domain Number 1 Region: 373-397
Classification Level Classification E-value
Superfamily Notch domain 0.0000654
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011787
Domain Number - Region: 903-975
Classification Level Classification E-value
Superfamily EF-hand 0.00265
Family Parvalbumin 0.059
Further Details:      
 
Domain Number - Region: 436-463
Classification Level Classification E-value
Superfamily Notch domain 0.00458
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011787   Gene: ENSMPUG00000011877   Transcript: ENSMPUT00000011980
Sequence length 1185
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:2980113:3054234:-1 gene:ENSMPUG00000011877 transcript:ENSMPUT00000011980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTKKSEKQLECLLTH
CIKVPMLVLDPALPANITLKELPSLYPSFHSASDIVNVAKPKNPSTNVSVVVFDSAKNVE
DAQSEIFKGNSRHTVWRGYLTTDKEVPGLVLMQDLAFLSGFPLTFKETNQLKTKLPENLS
SKIKLLQLYSEASVALLKLNNPKEFQELNKQTKKNMTIDGKELTISPAYLLWDLSAISQS
KQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQD
VFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLT
WPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNNGGSRYAAGGGGTGSIGIGQP
WQFGGGLNSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHFHELYKVTLLPNQ
THYVIPKGECLPYFSFAEIAKRGIEGAYSDNPIIRHASIANKWKTIHLIMHSGMNATTIH
FNLTFQNTNDEEFKIQITVEVDTREEPKVNSTTQKSYQNLVSPTTLLPEAEILFEDIPEE
KRFPKFKRHDVNTTGRFQVEVEIPLVNISLLPKEAQLSLSNLDLQLERGDITVKGYNLSK
SALLRSFLRSSPGAEVKINQALITDERNDSVEAPLEKQVHKSILPKSLGTSERLQRSTFS
AVTMKVNGHYQSQNPPPDLEIEEKFKSEILIQKVRGGSVSTEKLSSRIVPLEKQITKEKK
ITGKEREKTRMEENANNYVDVNEVLPGRKLQHYTDSYLGFLPWEKKKYFQDLLDEEESLK
TQLAYYTDSKHTGRKLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQD
MFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIR
TLATRIHDLPLSLQDLTGLEHMLINCSKMLPVNITLLNSVPPTQEAYYDPNLPPVTKSLV
TNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLN
DNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFW
THCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIQKEASPDRIRV
Download sequence
Identical sequences M3YKD0
ENSMPUP00000011787 ENSMPUP00000011787 XP_012906975.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]