SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011797 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011797
Domain Number 1 Region: 522-930,963-1066
Classification Level Classification E-value
Superfamily ARM repeat 0.00000576
Family Armadillo repeat 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011797
Domain Number - Region: 365-457
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.014
Family PLC-like (P variant) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011797   Gene: ENSMPUG00000011887   Transcript: ENSMPUT00000011990
Sequence length 1929
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897233.1:757285:962826:-1 gene:ENSMPUG00000011887 transcript:ENSMPUT00000011990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFQKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDL
VPRKDFEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSL
KSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNGGPRNPEKIERMCALFTDLSSK
DMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDFV
LKVYTCNNESEWSQIHENIIRKSSAKYSAPSASHGLIISLQLLRGDMEQIRRENPMIFGR
GLAITRKLGFPDVIMPGDIRNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDC
ISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDKGEKK
LFGFAFSPLMRDDGTTLSDDIHELYVYKCDENSTFNNHALYLGLPCCKEDYNGCPNIPSS
LIFQRSTKESFFISTQLSSTKLTQNVDLLALLKWKAFPDRIMDILGRLRHVSGEEIVKFL
QDILDTLFVILDDNTEKYGLLVFQSLVFIINLLRDIKYFHFRPVMDTYIQKHFAGALAYK
ELIRCLKWYMDCSAELIRQDHIQEAMRALEYLFKFIVQSRILYSRATCGMEEEQFRSSIQ
ELFQSIRFVLSLDSRNSETLLFTQAALLNSFPTIFDELLQMFTVQEVAEFVRGTLGSMPS
TVHIGQSMDVVKLQSIARTVDSRLFSFSESRRILLPVVLHHIHLHLRQQKELLICSGILG
SIFSIVKTSSLEADVMEEVEMMVESLLDVLLQTLLTIMSKSHAQEAVRGQRCPQCTAEIT
GEYVSCLLSLLRQMCDTHYQHLLDNFQSKDELKEFLLKIFCVFRNLMKMSVFPRDWMVMR
LLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKK
ILDKYGDMRVMMAYELFSMWQNLGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDM
MDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFGLLTQLFGPYPSLLEKVEQET
WRETGISFVTSVTRLMERLLDYRDCMKGEETENKKIGCTVNLMNFYKSEINKEEMYIRYI
HKLCDMHLQAENYTEAAFTLLLYCELLQWEERPLREFLHYPSQTEWQRKEGLCRKIIHYF
NKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIMEQQRLEPEFFRVGFYG
RKFPFFLRNKEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIY
AVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKENEFKSLWIERTTL
TLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALISQYQHKQVHGNINLLS
MCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKITQLKELMQEQVHVLGVGLAVHE
KFVHPEMRPLHKKLIDQFQMMRASLYHEFPGLDKLSPACSGTSTPRGNVLASHSPMSPES
IKMTHRHSPMNLMGTGRHSSSSLSSHASSEAGNVVMLGDSSVGEAPEDLYHHMQLAYPNP
RYQGSVTNVSVLSSSQASPSSSSLSSTHSAPSQMITSAPSSARGSPSLPDKYRHAREMML
LLPTHRDRPSSAMYPAAILENGQLPNFQRALFQQVVGSCKPCSDPNLSVAEKGHYSLHFD
AFHHPLGDTPPALPARTLRKSPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLSESNF
GHSSEAPPRTDTMDSMPSQAWNADEDLEPPYLPVHYSLSESAVLDSIKAQPCRSHSAPGC
VVPQDPMDPPALPPKPYHSRLPALEHEEGVLLREDADRPRGLHRKASLPPGSAKEEQARL
AWEHSRGEQ
Download sequence
Identical sequences M3YKE0
ENSMPUP00000011797 ENSMPUP00000011797 XP_004780180.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]