SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011832 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011832
Domain Number 1 Region: 257-625
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-114
Family Oxysterol-binding protein 0.0000301
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011832
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily PH domain-like 0.00139
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011832   Gene: ENSMPUG00000011922   Transcript: ENSMPUT00000012025
Sequence length 626
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896941.1:3108489:3429479:1 gene:ENSMPUG00000011922 transcript:ENSMPUT00000012025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVYSANGEMYKLRAADAKEKQFWVTQLRACAKYHMETSSKTTPSSRSRSLTLLPHGTP
NPASPCSQRHLGAGAPGVVTITHHKSPAAARRAKSQYPGQLHEVREMMNQVEGQQKNLVH
AIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLHLLQQSVQQVGQPSHKPGASENIL
GWHGPKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQSLPPEPEPNSGPELVLSED
EKSDTEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPTFILEKRSLLEMYADFMA
HPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCSWEVPKDR
VKPKRTAPHSPAGHEQLTAEDPSKSYKLRFVAEQVSHHPPISCFYCECKEKRLCVNTHVW
TKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPWVELGGKVSISCAKT
GYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYNSGETRVIDTT
TLPVYPKKIRPLEKQGPMESRNLWQEVTRYLRLGDIDAATEQKRHLEEKQRVEERKRENL
HTPWQPKYFIQEGDGWVYFNPLWKAH
Download sequence
Identical sequences M3YKH5
ENSMPUP00000011832 ENSMPUP00000011832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]