SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011846 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011846
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-80
Family IMD domain 0.00000000148
Further Details:      
 
Domain Number 2 Region: 355-417
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000101
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011846   Gene: ENSMPUG00000011938   Transcript: ENSMPUT00000012041
Sequence length 500
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:1547609:1598103:-1 gene:ENSMPUG00000011938 transcript:ENSMPUT00000012041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMA
EVHRQIQNQLEEMLKSFHNELLTQLEQKVELDARYLSAALKKYQTEQRSKGDALDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEK
QCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPERAVQLMQQVPSNGSVLPSALSA
SKSSLVISDPIPGAKPLPVPPELAPFVGRLSAQESAPAMNGVSGPDGEDYSPWADRKAAQ
PKTSSPPQSQSKLSDSYSNTLPVRKSVAPKNSYAATENKTLPRSSSMAAGLERNGRMRVK
AIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGS
DRLHMSLQQGKSSSTGNLLDKEELALPPPDYNASSRAFPAQTAGTFKQRPYSVAVPAFSQ
GLDDYGARAVSSADVDVARL
Download sequence
Identical sequences M3YKI9
ENSMPUP00000011846 ENSMPUP00000011846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]