SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011856 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000011856
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily Ras GEF 0.000366
Family Ras GEF 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011856   Gene: ENSMPUG00000011948   Transcript: ENSMPUT00000012051
Sequence length 156
Comment pep:novel scaffold:MusPutFur1.0:GL898492.1:2660:4057:1 gene:ENSMPUG00000011948 transcript:ENSMPUT00000012051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLSSDFSASMSVPRAVYAILNTCVEKYPGDFVQPPEFPSLHTLLAYLQVNVPGSDLQR
RAQLLLPERQRAPRKTTKQEAGGSCPRAAAPCVRGASRLGPRAAATCLRGASSLGPPAAA
PCLRGASMLRSRGAPRACYNQKACLSHPPYCFFCIS
Download sequence
Identical sequences M3YKJ9
ENSMPUP00000011856 ENSMPUP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]