SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011887 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011887
Domain Number 1 Region: 52-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000108
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011887   Gene: ENSMPUG00000011979   Transcript: ENSMPUT00000012082
Sequence length 257
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:1016921:1020016:1 gene:ENSMPUG00000011979 transcript:ENSMPUT00000012082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCGPEAALGGCSGSSPSSVPGCSEDCGQAACLVRAPRERPGSGSSLGLPRNVLSERER
RKRISVSCERLRALLPRFDGRREDMASVLEMSVQFLRLAGTLLPSQEPHTVLGPSREAWS
EWQTDVLPQALLRAGAAESPDRGAGASGLTVPSVPVSCGTAGAGEDEAPPGAAEVVERPP
VLPEPYSLLSQPPGPSAPQALRPPPLWPPGAWQPPSPLVSAEAQSCLGRAGPPAXXXXXX
XXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3YKN0
ENSMPUP00000011887 ENSMPUP00000011887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]