SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011889 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011889
Domain Number 1 Region: 232-423
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-72
Family T-box 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011889   Gene: ENSMPUG00000011981   Transcript: ENSMPUT00000012084
Sequence length 669
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896941.1:7066943:7072017:1 gene:ENSMPUG00000011981 transcript:ENSMPUT00000012084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGEQLLVSSVNLPGAHFYPLESARGGGSGSAGHLPGAAPSPQRLDLDKAPKKFPGSLS
CETGSGEATAASAGAPAAMLSDADAGDAFASAAAVAKPGPPDGRKGSXSLSSERYYLQSP
GPQGSELAAPCSLFPYQATAGAPHGSVYPTPNGARYPYGSMLPPGGFPASVCPPGRAQFG
PGAGASSGAGGPGAYQYSQGAPLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPL
WLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVT
CGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKY
QPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRD
NYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVP
QTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQT
SHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPPVFSEDQLSKEKVKEEISSS
WIETPPSIKSLDSNDSGVYTSACKRRRLSPSTSSNENSPSIKCEDINAEEYSKDTSKGMG
GYYAFYTTP
Download sequence
Identical sequences M3YKN2
ENSMPUP00000011889 ENSMPUP00000011889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]