SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011910 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011910
Domain Number 1 Region: 57-221
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-33
Family RUN domain 0.00000059
Further Details:      
 
Domain Number 2 Region: 584-650
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011910
Domain Number - Region: 425-524
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011910   Gene: ENSMPUG00000012002   Transcript: ENSMPUT00000012105
Sequence length 654
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897156.1:1835497:1889399:-1 gene:ENSMPUG00000012002 transcript:ENSMPUT00000012105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGGSRGLGGARGRHGNALPPFLLVPARVLGPNGRGLVLAWVPDAEGGRATKDPTAVERA
NLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTIW
GPLELVEKLYPEAEEIGASVRDLPGLNLFISNCKNWFRLTPGQRLSRDYLKNKTISISIL
NEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGN
KERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQ
EENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLR
QDVENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSE
DGLKEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDKKYLQECQSKSDNLQ
KQVSQKEKQLVQLETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIIDLKKEFLNIQD
ENQQLKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCETE
FSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQRCSSNLP
Download sequence
Identical sequences M3YKQ3
ENSMPUP00000011910 ENSMPUP00000011910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]