SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011917 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011917
Domain Number 1 Region: 54-134
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-20
Family PDZ domain 0.00058
Further Details:      
 
Domain Number 2 Region: 384-448
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.64e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 325-388
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.85e-18
Family LIM domain 0.029
Further Details:      
 
Domain Number 4 Region: 295-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000063
Family LIM domain 0.0047
Further Details:      
 
Domain Number 5 Region: 444-469
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000447
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011917   Gene: ENSMPUG00000012009   Transcript: ENSMPUT00000012112
Sequence length 474
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:4858865:4875801:1 gene:ENSMPUG00000012009 transcript:ENSMPUT00000012112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPPPPAGSKRAAAAGAGSEHGWWIPTRHFGASHRAAPRRGRAGAGTMESFKVVLEGPAP
WGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNRIRAC
GDRLSLGLSRAQPPQSKPQKVQTPDKQPLRPLVPDASKQRLMEDTEDWRPRPGTGQSRSI
RILAHLTGTEFMQDPDEEHLKKSSQVSRTEAPAPASATPQEPWLAPAGPTTPSPTSRPPW
AVDPAFAERYAPDKTSTVLTRHSQPATPTPLQNRTSIVQAAAGGGPGASSGNNGKTPVCH
QCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAK
CKKKITGEIMHALKMTWHVQCFTCAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGC
DFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Download sequence
Identical sequences M3YKR0
ENSMPUP00000011917 ENSMPUP00000011917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]