SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011922 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011922
Domain Number 1 Region: 404-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-93
Family Protein kinases, catalytic subunit 0.00000000902
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-29
Family PLC-like (P variant) 0.000000481
Further Details:      
 
Domain Number 3 Region: 236-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.33e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00039
Further Details:      
 
Domain Number 4 Region: 148-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011922   Gene: ENSMPUG00000012014   Transcript: ENSMPUT00000012117
Sequence length 736
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:8953356:9429533:1 gene:ENSMPUG00000012014 transcript:ENSMPUT00000012117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPTSGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAAGGAGQLASPGENGEVRQGQAKRLGLEEFTFIKVLGKGSFGK
VMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDR
LFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLD
AEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMM
AGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDA
IKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQIN
QEEFKGFSYFGEDLMP
Download sequence
Identical sequences M3YKR5 U6CTZ7
ENSMPUP00000011922 XP_004753051.1.14098 XP_004753052.1.14098 ENSMPUP00000011922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]