SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011941 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011941
Domain Number 1 Region: 31-173,205-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-59
Family BAR domain 0.00000648
Further Details:      
 
Domain Number 2 Region: 516-592
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-19
Family SH3-domain 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011941   Gene: ENSMPUG00000012033   Transcript: ENSMPUT00000012136
Sequence length 594
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897154.1:1333522:1386718:1 gene:ENSMPUG00000012033 transcript:ENSMPUT00000012136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWLDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNESLNDVLVSLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPP
PEGSPAATPEIRVNHEPEPPSSATAGASLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQIL
SLFDDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVASPVKAPTPSGQSIPWDL
WEPTESPAGSLPSREPSAAEGTFAVAWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGE
TAASEAASSSLPAVVVETFSATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYVATDTDEL
QLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ
Download sequence
Identical sequences M3YKT4
ENSMPUP00000011941 ENSMPUP00000011941 XP_004777855.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]