SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011987 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011987
Domain Number 1 Region: 400-447,504-703
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000856
Further Details:      
 
Domain Number 2 Region: 27-131
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-21
Family DNA ligase 0.059
Further Details:      
 
Domain Number 3 Region: 708-822
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.79e-16
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011987   Gene: ENSMPUG00000012079   Transcript: ENSMPUT00000012182
Sequence length 1254
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:10828638:10923493:-1 gene:ENSMPUG00000012079 transcript:ENSMPUT00000012182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGWRKRAENDGWEKWGGYMAAKVQKLEEQFRSDATLQKDGTSSTIFSGVAIYVNGYT
DPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKA
GRLLSCIPYQLYSKQSSMQKGLNFTPACKAEEPGPGPSSVVKQLNNRVNHIIKKIETENE
VKVNGMNSWNEEDANNDFNFMELEQIFPGRKQNGIPHHRDNTAIFNGHTPSSNGALKTQD
CLVPMGHSIASRLSPDFAQGEEQAEKSSTDFRDCVVHLSQQSTRNTDAVRNPHRTNSFSL
SSLHSNTKVNGAHHSAVQGPSSTKSTSSIPTLSKAAPSVPSKPSDCGFISDFYSRSRLHH
ISMWKCELTEFVSALQRQSSGVFPGREKLKKMKTGRSALVVTDTGNMSVLSSPRHQSCIM
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAA
EIPDSSLWENQDSAQANGIDSVLSKAEIASCSYEARQVGIRNGMFFGQAKQLCPSLQAVP
YDFHAYKEVARTMYETLASYTHNIEAVSCDEALVDITEILAETRLTPDEFANAVRMEIKD
QTKCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVSNLPGVGRSMESKL
TSLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSISAEINYGI
RFTQPKEAEAFLLNLSEEIQRRLEAAGMKGKRLTLKVMVRKPGAPVETAKFGGHGICDNI
TRTVTLDQATDSAKIIGKATLNMFHTMKLNISDMRGVGIQVNQLVPINPNPSACPSRPSV
QSSHFPGGSHSVLDLFQVQKAKKSIEEEHKEVFVAAMDLEISSASRNCTFMPSFSTHLTS
SVNPVTSKAESSGKWNGLHSPISLKSRLNLSIEVPSPSQLDQSVLEALPPDLREQIEQAC
AGQQGEQHGDKRKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGISVIALPAFSQVDP
EVFAALPAELQKELNAAYDQRQRQGENAAHQQLATASVPKNLLRQLKPAAVKEKKRNKKK
NPISSPKKIQSPLKNKLLTSPVKTLPGACGSPQKLIDGFLKHEGPASEKPLGELSASTSG
VPGLSSLQPEPAACRRPPAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVKYCTDL
IEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Download sequence
Identical sequences M3YKY0
XP_004753073.1.14098 XP_004753074.1.14098 ENSMPUP00000011987 ENSMPUP00000011987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]