SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012020 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012020
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-62
Family BAR domain 0.000000301
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-23
Family Pleckstrin-homology domain (PH domain) 0.0000142
Further Details:      
 
Domain Number 3 Region: 472-611
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-22
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012020   Gene: ENSMPUG00000012115   Transcript: ENSMPUT00000012218
Sequence length 660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:5859680:5910516:-1 gene:ENSMPUG00000012115 transcript:ENSMPUT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATHQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFAKVVDELNVLHTELAKQLADTMILPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKMDVVKEVAAARRKQHLSSLQ
YYCALNALQDRKRVAMMEPMIGFAHGQINFFKKGAEMFSQNMNSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYAPDFDVAAPQINRNLIQKAGYLNLRSKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESPCPSQHLRNV
ELENDKMVPTAAVPVPDADELIAPGTPIQFDIVLPASEFLDQNRGSRRINPFGETEDETF
PEAEDSLLQQMFIVRFLGSMAVKTDNTTEVIYEAMRQVLAARAIHNIFRTTESHLMVTSQ
TLRLIDPQTQVTRANFELTSITQFAAHQENKRLVGFVVRTPESTGGEALSTYVFESNSEG
EKICYAINLGKEIIEVQKDPEALAQLMLSVPLTNDGKYVLLNEQPDDGSPSENRGAESEA
Download sequence
Identical sequences M3YL13
XP_004743110.1.14098 ENSMPUP00000012020 ENSMPUP00000012020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]