SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012035 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012035
Domain Number 1 Region: 1142-1337
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 932-1055
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.00000053
Further Details:      
 
Domain Number 3 Region: 41-166
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012035   Gene: ENSMPUG00000012130   Transcript: ENSMPUT00000012233
Sequence length 1925
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896956.1:8528066:8664248:-1 gene:ENSMPUG00000012130 transcript:ENSMPUT00000012233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDGDKLKACGSPTCEVSKTKDGKEQSETVSPSEDETFSWPGPKTVMLKR
TSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKG
NEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEVSPPDPSSSKQQTSTPVLTQPSRAYR
MEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLTNRNNHTVPAHRTEEVRYGM
NEQTSLKTVSRTTSPSSSVPTTHLLHQTAGSRSLEPSGILLKSGNYSGHSEGISSSRPQA
VDSPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRSHIGCRTIQERLDSLRAASQSTTDY
NQVVPNRTALQVRRRSTSHDRGPQSVQIRQRSVSQERLEDSMLVTYCPRSASQGALTSPS
VSFSNHRTRSWDYIEGQGETLENVNSESQMPDSNGERKQTYKWSGFTEQDDRRGIYERPR
QQEIHKPFRGSNFTVAASVVNSDNRRMPGRGVGSVSQFKKVPPDLKPQQSNRNFPTTCGM
SLPRGVSQDRSPLVKVRSNSLKAPSTHVTKPSFNQNSFVSVKDQRPVNHLHQNSLLNQQT
WLRTESAPDHQVEPGKPPSLSGAAVAPAPQTTENSGALDLELSVTQRSQDLNLREADIQE
SDTLDSRETVVLREKPPSGRQTPQPLRHQSYILAVNDQDTGSDTTCWLPNDARREVHIKR
MEERKASSTSPPGDSLASIPFIDEPTSPSIDHDLAHIPASAVISGSTPQAPQAPSIAMVP
PSLATSAPLIRRQLSHDQESVGPPSLDAQPGSKTERSKSYDEGLDDYREDAKLSFKHVSS
LKGIKMVDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLITDKGKRVGGSIRPWKQMY
VVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTPDCECLFQA
EDRDDMLAWIKTIQESSTLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSIR
QTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTAT
GTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKG
MADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRL
IHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMP
DQYKIVETLIQHHDWFFTEEGVEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPGDV
SDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFF
KKENTEQSHNDIKEESKKESETLCRKQRIAISKENMAKKDPGAPKDEKTPPRKQSAASEE
PSPPHSAKPPKSPAPSCRFPGPRESPRPPGAPRSCPLEEPGSDSGSQASPAGLSAGKCGS
PGTRHRGFLAAPGALASDCPGAHPAGLDGSRLSPEVRSVAESRGDEADDERSERVSEGRP
VETDSETDFPVFPGALASERLLRGPLQDAGKAGRRNSEGSELSGTEGSLTPSLDSRRPLF
SSHKLIECDTLSRRKSGRFKSDSGGLGDARGDRDSPAISRVFDVMKKGKSTGSLLPPSRS
ESEKQEPTWKTKIADRLKLRPRAPADDMFGVGSQKAGAEAAKRKSIKRRHTLGGHRDAAE
LSVLSFWKAHEQAADRDAELSAVHRLKPKCSAQDLSISDWLARERLRTSASDLSGADTGD
PAPHGGARAVDGAAPDAPQSSQPTAGASPGAPAPAPRPLLSIPPPDQINGESFQNMSQNA
SSAAL
Download sequence
Identical sequences M3YL28
XP_012914393.1.14098 ENSMPUP00000012035 ENSMPUP00000012035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]