SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012040 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012040
Domain Number 1 Region: 215-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.31e-72
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 105-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-28
Family Nuclear receptor 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012040   Gene: ENSMPUG00000012135   Transcript: ENSMPUT00000012238
Sequence length 461
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896941.1:10127227:10348624:1 gene:ENSMPUG00000012135 transcript:ENSMPUT00000012238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNSMTENGLPAWDKPKHCPDREHDWKLVGMSEACLHRKSHAERRSALKNEQSSPHLIQ
ATWTSSIFHLDHDDVNDQSIASAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences M3YL33
ENSMPUP00000012040 XP_004754409.1.14098 XP_012912636.1.14098 XP_012912637.1.14098 ENSMPUP00000012040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]