SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012042 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012042
Domain Number 1 Region: 377-574
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012042   Gene: ENSMPUG00000012137   Transcript: ENSMPUT00000012240
Sequence length 576
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896941.1:10475014:10503913:-1 gene:ENSMPUG00000012137 transcript:ENSMPUT00000012240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDNNGNPKNGDL
SNIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLEHHEQTALPAQEQLRPKPQLEQENIKSS
SPSSDFAKDEVIGMVTRAHKDTFLYNQEQRENSAETMQPQRERIPKGMEQYNLNHDHCGS
GLSSHFPCSESQQHLNGQYKGRNIMHYPNGHAICIANGHCMNFSNAYIQRVCDRVSIDGF
SQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
NSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences M3YL35
ENSMPUP00000012042 XP_004754415.1.14098 ENSMPUP00000012042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]