SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012047 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012047
Domain Number 1 Region: 70-166
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.01e-23
Family Middle domain of MutM-like DNA repair proteins 0.013
Further Details:      
 
Domain Number 2 Region: 230-256
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000647
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012047   Gene: ENSMPUG00000012143   Transcript: ENSMPUT00000012246
Sequence length 517
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897114.1:1641318:1673581:1 gene:ENSMPUG00000012143 transcript:ENSMPUT00000012246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFGPKALRIHFGMKGSIMINPLEHKNKNGVSPVFELQLTKDLICFFDSSVEFRNSTESQ
QRVRMMEELDVCSPKFSFSRAESEVKKQKGRMLCDVLMDQKVLPGVGNIIRNEALFDSGL
HPAVKVCQLTDEQTHYLVKMIRDFSILFYRCHKTGSVISKHYKVYKRPHCCQCCCKITVC
RLGENNRMTYFCPRCQKENPQHVDICKLPTRNTTIRWPCSRGEHVARKWEEQWACVVCTL
INSPSSKTCAACLTSRPPDSVIENEEHSIAFTDLVRYPCNSFGKPSKEVKINRKTAFGTT
TLVLADFSNKSSALERKTSQNQTLDGEFQNRSPTHVCFNDPLHRSEDRANHGSQPSDKAN
VSPSLCPQSELFSPAYKKLKTTHSSSPDLRSGKPGFPASELGIKLTDGTWALHADRPRCS
KHSRRCVLRVVRKDGENKNRQFYACPLPREEQCGFFQWADLSFPFCNHGKRSIMRTVLKI
GPNNGKNFFVCPLGKAKQCNFFQWAENGPGVKFIPGC
Download sequence
Identical sequences M3YL40
XP_012902799.1.14098 ENSMPUP00000012047 ENSMPUP00000012047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]