SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012064 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012064
Domain Number 1 Region: 478-579
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012064   Gene: ENSMPUG00000012160   Transcript: ENSMPUT00000012263
Sequence length 606
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:2153100:2169015:-1 gene:ENSMPUG00000012160 transcript:ENSMPUT00000012263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSVKALGQARPSGAGMAPQTRCCSLAAVQRRLPILAWLPNYSLRWLKMDLVAGLSVGL
TVVPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGFLHLGFLLDFISYPVIKGFTSAATVTIGFGQIKNLLGLQDIP
RQFFLQVYQTFRKVGEIRAGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSHGLV
WTATTGRNALVVSFAALIAYSFEVTGYQPFILTGQTAEGLPPVRIPPFSVTTANGTVSFT
EMVQDMGAGLAVVPLMGLLESIAVAKSFASQGGYRVDSNQELLAIGLTNVLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TRVFGTLWRVKRLDLLPLCVTFLFCFWEVQYGILAGTLVSVLILLHSVARPKMQVSEGPV
LVLQPASGLQFPAVEALREAIITQALEASPPRSAILECSHVCSVDSTVVLGLEELLEDFH
RRGVTLALVGLQVPVLRVLLSADLKGLQYFSTLEEAEKSLLQEPGTQPYNVGEDSIPEHK
VALLKA
Download sequence
Identical sequences M3YL57
ENSMPUP00000012064 ENSMPUP00000012064 XP_004748800.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]