SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012080 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012080
Domain Number 1 Region: 287-544
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-82
Family Nuclear receptor ligand-binding domain 0.00000000102
Further Details:      
 
Domain Number 2 Region: 218-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012080   Gene: ENSMPUG00000012176   Transcript: ENSMPUT00000012279
Sequence length 548
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:1759216:1798515:-1 gene:ENSMPUG00000012176 transcript:ENSMPUT00000012279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASLAPDAGSCLVATLVLPCLLSLPAPCRPCTAALHRRRPWDPEPEGRGLMGPPPWWDL
SPTLTMRLHLLASLSGGGLAWRPGDHRWLADFSTQVNSSSLSSPTGRGSMAAPSLHPSLG
PGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPALGFGTGSPQL
SSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEG
CKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKD
RSESEVESTSSANEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPNDPVTNICQAADK
QLFTLVEWAKRVPHFSELPLDDQVILLRAGWNELLIASFSHRSITVKDGILLATGLHVHR
NSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALRE
KVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEM
LEAPHQMT
Download sequence
Identical sequences M3YL73
ENSMPUP00000012080 ENSMPUP00000012080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]