SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012083 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012083
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-32
Family Ras-binding domain, RBD 0.003
Further Details:      
 
Domain Number 2 Region: 315-423
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-16
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012083   Gene: ENSMPUG00000012179   Transcript: ENSMPUT00000012282
Sequence length 661
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896956.1:10125487:10233599:1 gene:ENSMPUG00000012179 transcript:ENSMPUT00000012282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNEDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKLPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQRPPASLEMPDFSGAGALGYGANVAAVS
VSHYENDLPPPPADPMVDLPPPPPPPKPLSQEEEAAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLTRDVLDNLFEKTHCDCNVDWCLYEIYTELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLDNKGKKDGKKDGKETNEKMNAKNKE
SLLEESFCGSSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACF
IQFKNVNIYYGIQCKMRYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRI
AKYGKTLFDNYQRAVERAGLASRWTNLGPASAAPPSTGLKAGTTQANGQIPQAVHSVSAV
LEEAQRHAETAKDKKPAFGNHDPGAPRAHQLPKSSLPPPPPVRRSSDVCGSPATVPRAKG
PRGGFPAPPDDSLPPPPPPPPLEDDELPPPPPDFNDGPPDFVPPPPPSFAGEAGSQLPPP
PPPPPAPAPEAPKPPPVGVKRPPAPPKRKENPGPPGGGGSGEQDFMSDLMKALQKKRGNM
S
Download sequence
Identical sequences M3YL76
XP_004757695.1.14098 XP_004757696.1.14098 ENSMPUP00000012083 ENSMPUP00000012083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]