SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012100 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012100
Domain Number 1 Region: 242-549
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.32e-88
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 62-186
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-35
Family Synaptotagmin-like (S variant) 0.0000016
Further Details:      
 
Domain Number 3 Region: 5-58
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012100   Gene: ENSMPUG00000012196   Transcript: ENSMPUT00000012299
Sequence length 577
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897170.1:572247:886979:1 gene:ENSMPUG00000012196 transcript:ENSMPUT00000012299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHT
ERRGRIYIQAHIEREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIK
CSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFK
LLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDR
MKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLAL
PGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFF
LQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQ
PYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLM
TKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRH
PPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS
Download sequence
Identical sequences M3YL93
ENSMPUP00000012100 ENSMPUP00000012100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]