SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012107 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012107
Domain Number 1 Region: 15-114
Classification Level Classification E-value
Superfamily PDZ domain-like 1.54e-21
Family PDZ domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012107   Gene: ENSMPUG00000012203   Transcript: ENSMPUT00000012306
Sequence length 124
Comment pep:known scaffold:MusPutFur1.0:GL897350.1:90934:94911:-1 gene:ENSMPUG00000012203 transcript:ENSMPUT00000012306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYVPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ
SMLS
Download sequence
Identical sequences A0A2F0BAC2 A0A2K5CLM2 G9KSG9 H0XNH0 L8HZA8 Q3ZCD3
NP_001029646.1.59421 NP_001029646.1.76553 XP_003799101.1.62490 XP_004267078.1.21590 XP_004594036.1.84141 XP_004781995.1.14098 XP_005349663.1.66349 XP_005693468.1.57651 XP_005906741.1.15283 XP_005975778.1.78601 XP_006079765.1.26621 XP_007125533.1.24612 XP_007177503.1.59432 XP_007454242.1.90284 XP_010845779.1.44457 XP_012002253.1.54773 XP_012303785.1.9421 XP_019837011.1.53367 XP_020736837.1.74333 XP_020736838.1.74333 XP_021510307.1.76796 ENSMPUP00000012107 ENSBTAP00000001098 ENSOGAP00000017661 ENSMPUP00000012107 ENSBTAP00000001098 9913.ENSBTAP00000001098 ENSOGAP00000017661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]