SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012131 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012131
Domain Number 1 Region: 263-587
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-81
Family p120GAP domain-like 0.0000953
Further Details:      
 
Domain Number 2 Region: 547-684
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-42
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 115-275
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.33e-27
Family Synaptotagmin-like (S variant) 0.0096
Further Details:      
 
Domain Number 4 Region: 3-101
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-20
Family PLC-like (P variant) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012131   Gene: ENSMPUG00000012228   Transcript: ENSMPUT00000012331
Sequence length 792
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896943.1:6474565:6583164:-1 gene:ENSMPUG00000012228 transcript:ENSMPUT00000012331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRI
GKVAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIM
ACHGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRK
SQFQVEEEDIEKLEIRIDLWNNGNLVQDIFLGEIKVPVNVLRNDSSHQAWYLLQPRDNGN
KSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILGEICRDKN
DAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYL
KVTLKPILDEICESSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFSTIVKSSMSCPTVM
CDTFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDPQTVRTL
TLISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESS
GTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKNI
LAVEKLEESSFNKKNMFQVIHMEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPS
AYLNGNWLCCLETSENALGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEE
ACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKY
GSKENPIVGKTS
Download sequence
Identical sequences M3YLC4
ENSMPUP00000012131 ENSMPUP00000012131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]