SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012194 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012194
Domain Number 1 Region: 201-585
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-163
Family Myotubularin-like phosphatases 0.000000000000578
Further Details:      
 
Domain Number 2 Region: 75-198
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-45
Family GRAM domain 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012194   Gene: ENSMPUG00000012291   Transcript: ENSMPUT00000012394
Sequence length 643
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896943.1:8265581:8387038:-1 gene:ENSMPUG00000012291 transcript:ENSMPUT00000012394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPD
LRVLRESNKLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERD
PPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDSLLEYRRQGIPNESWRITKINERYELCDTY
PALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDE
KYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMR
ESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRSIRGFEVLVEKEWLSFGHRFQLRLGHGDKNHADADRSPVF
LQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSELQRGKENLPKRTVSL
WSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYVRWNPRMKPQEPIHNRYKEL
LAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences M3YLI7
ENSMPUP00000012194 ENSMPUP00000012194 XP_004754602.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]